PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013901336.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 811aa    MW: 85370.1 Da    PI: 7.8482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013901336.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.3e-131657143
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                     r +WT++Ed+ll  avk +G + W+t+a+ ++ gR+ k+c +r
   XP_013901336.1 16 RSAWTEQEDDLLRAAVKNYGDRAWATVANDVP-GRSSKSCSDR 57
                     789*****************************.*******766 PP

2Myb_DNA-binding27.38.5e-0984123142
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                      + +++++E    v+a +++G++ Wk+I+  ++ gRt   +k+
   XP_013901336.1  84 KSPFSEWEVAVVVQAQHRYGNN-WKAISMLLP-GRTNRAVKN 123
                      579*****************99.*********.****99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9331179IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-151476IPR009057Homeodomain-like
SMARTSM007176.6E-91564IPR001005SANT/Myb domain
PfamPF002491.5E-111657IPR001005SANT/Myb domain
SuperFamilySSF466892.35E-1716125IPR009057Homeodomain-like
CDDcd001679.09E-101857No hitNo description
Gene3DG3DSA:1.10.10.604.9E-977128IPR009057Homeodomain-like
PROSITE profilePS512949.09481133IPR017930Myb domain
SMARTSM007172.0E-583131IPR001005SANT/Myb domain
PfamPF002493.2E-684123IPR001005SANT/Myb domain
CDDcd001672.97E-586123No hitNo description
SuperFamilySSF819955.75E-5532595No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MRGEAGQMHL NSAQSRSAWT EQEDDLLRAA VKNYGDRAWA TVANDVPGRS SKSCSDRRTC  60
RSRPHPALHR WRNFLSPDIE HPRKSPFSEW EVAVVVQAQH RYGNNWKAIS MLLPGRTNRA  120
VKNLFVGNLK WGARLPEIQN RYLETKTPLE DLLEVKPDYA GGPPKERPAL LMGPHGAHRQ  180
QHHALGGHHG LALGGSASPS SLVAASTSSA GSAWASDMTD QPMAGGAPLH GVPHYSGVPS  240
HLGGGRRPRE GTEGGSPSGG MGTPKAANKR RRGGGPGGSP AGGAAHPCAS ESGAGQALVD  300
GPVHLDMSGM GVGVQGIGMG LGLGGGGMPA YLSADMGAPM QGLAPMQPLH DPSAAHQLQL  360
MAQQQQQQHQ QQQMLMQQQR MQQQQMHMHP QHHMSHGRLD THSHHGAHSH HHHQQQQHPS  420
VPSLHALSPG SDNDHTTHAP LGGAIGGSGG DGLLASLQGH QSNDSMMLQQ IMDQILEDDE  480
MLSDPAMTKH LLGSPTSSPL LPPHCGASSG GAAAGATACE GAAGMARAST WPNTWPDTQQ  540
QQQQQQQQQQ QQQQQQQQQQ VQQQQQQQQQ LKLEQQQQQQ PQQHGLIPFD CGRTSPAMRT  600
SSCGAAGMGA PLPPRALAGA PPCGWWSGGG PGEGGDVVTG SVTAGSFLHP SRRVSTGDFA  660
SGDVLGGAHR HNGAAPGGPP TPGAGAPAGG GQLQHVKLEQ QQQPPQQQPQ QQQQQQPQMM  720
RMLCHQLQQE NLLLMQRVHS LQERLAGTPA PQPQPDSLGL APCLPPLAPP QPAPAASPSP  780
AAAGGWAGVP TPPLLGPGAG GKHEDARAQL P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-15712318118MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013901336.10.0hypothetical protein MNEG_5639
TrEMBLA0A0D2MP650.0A0A0D2MP65_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.15e-20myb domain protein 77
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]